Proteintech, 98382-2-RR, Anti-Mouse TWEAKR/CD266 Rabbit Recombinant Antibody

Size: 100ug The TWEAKR/CD266 (98382-2-RR) by Proteintech is a Recombinant antibody targeting TWEAKR/CD266 in FC applications with reactivity to mouse samples 98382-2-RR targets TWEAKR/CD266 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information TWEAKR (also known as CD266, FN14, TNFRSF12A) is a member of the TNF receptor superfamily which is activated by its ligand, the cytokine TWEAK (TNFSF12). TWEAKR is the smallest member of the TNFR superfamily. TweakR was first described as an FGF-inducible gene that played a role in fibroblast adhesion and migration. Subsequently, the induction of TweakR expression by other growth factors and/or upon tissue injury was observed in multiple cell types, including hepatocytes, endothelial cells, adipocytes, and cardiomyocytes. (PMID: 23073510, PMID: 24409185) Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1838 Product name: Recombinant Mouse TWEAKR/CD266 protein (rFc Tag) (HPLC-verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 28-80 aa of NM_013749.2 Sequence: EQAPGTSPCSSGSSWSADLDKCMDCASCPARPHSDFCLGCAAAPPAHFRLLWP Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 12a Calculated Molecular Weight: 14kDa GenBank Accession Number: NM_013749.2 Gene Symbol: Tnfrsf12a Gene ID (NCBI): 27279 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9CR75 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.