Proteintech, 98387-1-RR, Anti-Human CD16 Rabbit Recombinant Antibody

Size: 100ug The CD16 (98387-1-RR) by Proteintech is a Recombinant antibody targeting CD16 in FC applications with reactivity to human samples 98387-1-RR targets CD16 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human peripheral blood leukocyte Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information CD16 is a 50-70-kDa low affinity Fc receptor found on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. CD16 mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis. CD16 has been identified as Fc receptors FcγRIIIa (CD16a) and FcγRIIIb (CD16b), encoded by two nearly identical genes, FCGR3A and the FCGR3B. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg31662 Product name: Recombinant Human FCGR3A/CD16a (F176V) protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 17-208 aa of BC017865 Sequence: GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ Predict reactive species Full Name: Fc fragment of IgG, low affinity IIIa, receptor (CD16a) Calculated Molecular Weight: 254 aa, 29 kDa GenBank Accession Number: BC017865 Gene Symbol: CD16a Gene ID (NCBI): 2214 ENSEMBL Gene ID: ENSG00000203747 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P08637 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.