Proteintech, 98390-1-RR, Anti-Human JAM2/CD322 Rabbit Recombinant Antibody

Size: 100ug The JAM2/CD322 (98390-1-RR) by Proteintech is a Recombinant antibody targeting JAM2/CD322 in FC applications with reactivity to human samples 98390-1-RR targets JAM2/CD322 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Junctional adhesion molecules (JAMs) are integral membrane proteins belonging to the immunoglobulin (Ig) superfamily. JAMs are expressed by leukocytes, platelets, endothelial, and epithelial cells and localized at the tight junction of polarized cells and on the cell surface of leukocytes. JAM-2, also known as CD322, VE-JAM or JAM-B, is specifically expressed in lymphatic endothelial cells and endothelial venules. JAM2 regulates cell-cell adhesion and signaling by interacting with other tight junction proteins such as PAR-3 and ZO-1. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2914 Product name: Recombinant Human JAM2 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 29-236 aa of NM_021219.3 Sequence: FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLN Predict reactive species Full Name: junctional adhesion molecule 2 Calculated Molecular Weight: 33 kDa GenBank Accession Number: NM_021219.3 Gene Symbol: JAM2 Gene ID (NCBI): 58494 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P57087-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.