Proteintech, 98403-3-RR, Anti-Human TNFSF18 Rabbit Recombinant Antibody

Size: 100ug The TNFSF18 (98403-3-RR) by Proteintech is a Recombinant antibody targeting TNFSF18 in FC applications with reactivity to human samples 98403-3-RR targets TNFSF18 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: HUVEC cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information TNFSF18 (Tumor Necrosis Factor Superfamily Member 18), also known as GITRL (Glucocorticoid-Induced TNF Receptor Ligand) or AITRL (Activation-Induced T Cell Receptor Ligand), is a cytokine belonging to the tumor necrosis factor (TNF) ligand family. TNFSF18 is broadly expressed in various tissues, including the gallbladder, brain, and other tissues. TNFSF18 is expressed on the surface of antigen-presenting cells (APCs) such as dendritic cells, macrophages, and B cells. It is also found in endothelial cells, which play a role in the interaction between T lymphocytes and endothelial cells. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg32094 Product name: Recombinant Human TNFSF18 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: N-6*his Domain: 50-177 aa of BC069319 Sequence: QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS Predict reactive species Full Name: tumor necrosis factor (ligand) superfamily, member 18 Calculated Molecular Weight: 177 aa, 20 kDa GenBank Accession Number: BC069319 Gene Symbol: TNFSF18 Gene ID (NCBI): 8995 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UNG2 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.