Proteintech, 98410-3-RR, Anti-Human CXCL4/PF4 Rabbit Recombinant Antibody

Size: 100ug The CXCL4/PF4 (98410-3-RR) by Proteintech is a Recombinant antibody targeting CXCL4/PF4 in FC (Intra) applications with reactivity to human samples 98410-3-RR targets CXCL4/PF4 in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: human PBMCs Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CXCL4, also known as platelet factor 4 (PF-4), is the oldest member of the chemokine family. CXCL4 is a chemokine produced by activated platelets and immune cells involved in pathological conditions such as cancer, infections and inflammatory diseases like systemic sclerosis (SSc), rheumatoid arthritis (RA) and psoriatic arthritis (PsA), among others. CXCL4 is present in the α-granules of platelets in amounts that constitute up to 2% platelet protein mass. CXCL4 plays a determinant role in distinct physiological processes such as in hematopoiesis, angiogenesis, coagulation and modulation of immune responses. For instance, CXCL4 can prevent monocyte apoptosis and promote cell survival, induces the production of TNF and reactive oxygen species (ROS) and promotes monocyte differentiation into a unique macrophage-like phenotype. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2129 Product name: Recombinant Human CXCL4/PF4 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 32-101 aa of NM_002619.4 Sequence: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES Predict reactive species Full Name: platelet factor 4 Calculated Molecular Weight: 11 kDa GenBank Accession Number: NM_002619.4 Gene Symbol: PF4 Gene ID (NCBI): 5196 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02776 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.