Proteintech, 98438-1-RR, Anti-Human TGFBR2 Rabbit Recombinant Antibody

Size: 100ug The TGFBR2 (98438-1-RR) by Proteintech is a Recombinant antibody targeting TGFBR2 in FC applications with reactivity to human samples 98438-1-RR targets TGFBR2 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs, human peripheral blood leukocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information TGF beta Receptor II (TGFBR2) is a member of the transforming growth factor-β (TGF-β) superfamily, which are critical regulators of cell proliferation and differentiation, developmental patterning and morphogenesis, and disease pathogenesis (PMID: 10974075). TGFBR2 is a serine/threonine kinase and the primary ligand-binding receptor. After binding of the ligand TGF-β1, TGFBR2 forms a heterodimer complex with TGFBR1, causing conformational changes and signal propagation via canonical (SMAD-dependent) and non-canonical (SMAD-independent) routes. Upon translocation into the nucleus, activated SMAD complexes can interact with various transcription factors to control target gene expression (PMID: 31454892). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2943 Product name: Recombinant Human TGFBR2 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 23-159 aa of NM_003242.5 Sequence: TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD Predict reactive species Full Name: transforming growth factor, beta receptor II (70/80kDa) Calculated Molecular Weight: 65 kDa GenBank Accession Number: NM_003242.5 Gene Symbol: TGFBR2 Gene ID (NCBI): 7048 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P37173-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.