Proteintech, 98440-2-RR, Anti-Mouse CD69 Rabbit Recombinant Antibody

Size: 100ug The CD69 (98440-2-RR) by Proteintech is a Recombinant antibody targeting CD69 in FC applications with reactivity to mouse samples 98440-2-RR targets CD69 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: anti-CD3/CD28 treated mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD69, also known as AIM, EA-1, Leu-23, and MLR3, is a type II transmembrane glycoprotein that belongs to the C-type lectin superfamily (PMID: 8340758; 7804122). CD69 is constitutively expressed by mature thymocytes, platelets, several subsets of tissue resident immune cells (including resident memory T cells and gamma delta T cells), and is inducibly expressed by activated T cells, B cells, natural killer (NK) cells, monocytes, neutrophils (PMID: 8100776; 28475283). CD69 has been identified as an early activation marker of lymphocytes and is commonly used as a marker of activated lymphocytes and NK cells (PMID: 28475283; 25759842). It is involved in the regulation of immune responses (PMID: 15745855). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3835 Product name: Recombinant Mouse CD69 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 62-199 aa of NM_001033122.3 Sequence: NVGKYNCPGLYEKLESSDHHVATCKNEWISYKRTCYFFSTTTKSWALAQRSCSEDAATLAVIDSEKDMTFLKRYSGELEHWIGLKNEANQTWKWANGKEFNSWFNLTGSGRCVSVNHKNVTAVDCEANFHWVCSKPSR Predict reactive species Full Name: CD69 antigen Calculated Molecular Weight: 23 kDa GenBank Accession Number: NM_001033122.3 Gene Symbol: Cd69 Gene ID (NCBI): 12515 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P37217 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.