Proteintech, 98457-1-RR, Anti-Rat CD31 Rabbit Recombinant Antibody

Size: 100ug The CD31 (98457-1-RR) by Proteintech is a Recombinant antibody targeting CD31 in FC applications with reactivity to rat samples 98457-1-RR targets CD31 in FC applications and shows reactivity with rat samples. Tested Applications Positive FC detected in: rat splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD31, also known as PECAM1 (Platelet endothelial cell adhesion molecule), is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. It is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, CD31 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489). Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1456 Product name: recombinant rat CD31/PECAM-1 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 18-589 aa of NP_113779.1 Sequence: QENSFTINSIHMESRPSWEVSNGQKLTLQCLVDISTTSKSRPQHQVLFYKDDALVYNVSSSEHTESFVIPQSRVFHAGKYKCTVILNSKEKTTIEYQLTVNGVPMPEVTVDKKEVTEGGIVTVNCSMQEEKPPIYFKIEKVELGTKNVKLSREKTSNMNFVLIEFPIEEQDHLLVFRCQAGVLSGIKMQTSEFIRSEYVTVQEFFSTPKFQIQPPEMIIEGNQLHIKCSVQVAHLAQEFPEIIIQKDKAIVATSKQSKEAVYSVMALVEHSGHYTCKVESNRISKASSILVNITELFPRPKLELSSSRLDQGEMLDLSCSVSGAPVANFTIQKEETVLSQYQNFSKIAEERDSGLYSCTAGIGKVVKRSNLVPVQVCEMLSKPRIFHDAKFEIIKGQIIGISCQSVNGTAPITYRLLRAKSNFQTVQKNSNDPVTFTDKPTRDMEYQCIVDNCHSHPEVRSEILRVKVIAPVDEVTISILSGNDVQSGDEMVLRCSVKEGTGPVTFQFYKEKEGRPFHEETVNDTQVFWHHEQTSKEQEGQYYCTAFNRASIVTSLRSGPLTVRVFLAPWKK Predict reactive species Full Name: platelet/endothelial cell adhesion molecule 1 Calculated Molecular Weight: 76kDa GenBank Accession Number: NP_113779.1 Gene Symbol: Pecam1 Gene ID (NCBI): 29583 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q3SWT0 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.