Iright
BRAND / VENDOR: Proteintech

Proteintech, 98465-2-RR, Anti-Human TACSTD2/TROP2 Rabbit Recombinant Antibody

CATALOG NUMBER: 98465-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The TACSTD2/TROP2 (98465-2-RR) by Proteintech is a Recombinant antibody targeting TACSTD2/TROP2 in FC applications with reactivity to human samples 98465-2-RR targets TACSTD2/TROP2 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: MCF-7 cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Trophoblast cell surface antigen 2 (TROP2), also named as TACSTD2, is a transmembrane glycoprotein. TROP2 plays a role in transducing intracellular calcium signals. It is expressed in trophoblast cells, cornea and multi-stratified epithelia. TROP2 is overexpressed in most carcinomas and is involved in cancer proliferation, migration, invasion, and metastasis. Congenital mutations of TROP2 cause a rare autosomal recessive disease which may lead to blindness-the gelatinous drop-like corneal disease (PMID: 35688908). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3329 Product name: Recombinant Human TACSTD2/TROP2 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 27-274 aa of BC009409 Sequence: HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT Predict reactive species Full Name: tumor-associated calcium signal transducer 2 Calculated Molecular Weight: 36 kDa GenBank Accession Number: BC009409 Gene Symbol: TROP2 Gene ID (NCBI): 4070 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P09758 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924