Proteintech, 98482-3-RR, Anti-Mouse CCL6 Rabbit Recombinant Antibody

Size: 100ug The CCL6 (98482-3-RR) by Proteintech is a Recombinant antibody targeting CCL6 in FC (Intra) applications with reactivity to mouse samples 98482-3-RR targets CCL6 in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2957 Product name: Recombinant Mouse CCL6 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-116 aa of NM_009139.3 Sequence: GLIQEMEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA Predict reactive species Full Name: chemokine (C-C motif) ligand 6 Calculated Molecular Weight: 13 kDa GenBank Accession Number: NM_009139.3 Gene Symbol: Ccl6 Gene ID (NCBI): 20305 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P27784 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.