Proteintech, 98487-2-RR, Anti-Mouse VISTA Rabbit Recombinant Antibody

Size: 100ug The VISTA (98487-2-RR) by Proteintech is a Recombinant antibody targeting VISTA in FC applications with reactivity to mouse samples 98487-2-RR targets VISTA in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information VISTA, also known as platelet receptor Gi24, B7-H5, C10orf54, Dies1, PD-1H, and SISP1, is a member of the immunoglobulin superfamily. It serves not only as a positive regulator but also as a substrate of MT1-MMP and contributes at least in part to tumor invasion. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2809 Product name: Recombinant Mouse VISTA protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 33-191 aa of NM_001159572.1 Sequence: FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAA Predict reactive species Full Name: RIKEN cDNA 4632428N05 gene Calculated Molecular Weight: 34 kDa GenBank Accession Number: NM_001159572.1 Gene Symbol: 4632428N05Rik Gene ID (NCBI): 74048 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9D659 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.