Iright
BRAND / VENDOR: Proteintech

Proteintech, 98498-1-RR, Anti-Mouse TNFR1/CD120a Rabbit Recombinant Antibody

CATALOG NUMBER: 98498-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The TNFR1/CD120a (98498-1-RR) by Proteintech is a Recombinant antibody targeting TNFR1/CD120a in FC applications with reactivity to mouse samples 98498-1-RR targets TNFR1/CD120a in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Tumor necrosis factor (TNF) is a multifunctional cytokine that plays a key role in regulating inflammation, immune functions, host defense, and apoptosis (PMID: 16407280). TNF exists in soluble and membrane-bound forms. TNF signals through two distinct cell surface receptors, TNFR1 (TNFRSF1A, CD120a) and TNFR2 (TNFRSF1B, CD120b). Whereas TNFR1 is widely expressed, expression of TNFR2 is limited to cells of the immune system, endothelial cells, and nerve cells (PMID: 22053109). TNFR1, which contains a death domain (DD) within its intracytoplasmic region, is thought to be the key receptor for TNF signaling (PMID: 16407280). This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0733 Product name: recombinant mouse TNF-RI/TNFRSF1A protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 30-212 aa of NM_011609.4 Sequence: LVPSLGDREKRDSLCPQGKYVHSKNNSICCTKCHKGTYLVSDCPSPGRDTVCRECEKGTFTASQNYLRQCLSCKTCRKEMSQVEISPCQADKDTVCGCKENQFQRYLSETHFQCVDCSPCFNGTVTIPCKETQNTVCNCHAGFFLRESECVPCSHCKKNEECMKLCLPPPLANVTNPQDSGTA Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 1a Calculated Molecular Weight: 50KDa GenBank Accession Number: NM_011609.4 Gene Symbol: Tnfrsf1a Gene ID (NCBI): 21937 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P25118 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924