Product Description
Size: 100ug
The CCL22/MDC (98501-2-RR) by Proteintech is a Recombinant antibody targeting CCL22/MDC in FC (Intra) applications with reactivity to mouse samples
98501-2-RR targets CCL22/MDC in FC (Intra) applications and shows reactivity with mouse samples.
Tested Applications
Positive FC (Intra) detected in: Transfected HEK-293T cells
Recommended dilution
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
Background Information
The C-C motif chemokine ligand 22 (CCL22), also known as MDC, belongs to the group of chemokines, that are both constitutively expressed under homeostatic conditions and inducible upon inflammation. CCL22 is a secreted protein that exerts chemotactic activity for monocytes, dendritic cells, natural killer cells, and for chronically activated T lymphocytes. CCL22 is induced by LPS, IL-4, and IL-13 and in T cells by TCR stimulation. Accumulating studies indicate that CCL22 recruits regulatory T (T-reg) cells into tumor tissues and is expressed in many human tumors.
Specification
Tested Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Eg2241 Product name: Recombinant Mouse CCL22 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 25-92 aa of NM_009137 Sequence: GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS Predict reactive species
Full Name: chemokine (C-C motif) ligand 22
Calculated Molecular Weight: 10kd
GenBank Accession Number: NM_009137
Gene Symbol: CCL22/MDC
Gene ID (NCBI): 20299
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: O88430
Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924