Iright
BRAND / VENDOR: Proteintech

Proteintech, 98505-5-RR, Anti-Mouse S100A9 Rabbit Recombinant Antibody

CATALOG NUMBER: 98505-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The S100A9 (98505-5-RR) by Proteintech is a Recombinant antibody targeting S100A9 in FC (Intra) applications with reactivity to mouse samples 98505-5-RR targets S100A9 in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: C57BL/6 bone marrow cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information S100A9 is a calcium binding protein as a member of the S100 family of proteins. S100 proteins are low molecular weight (9 to 14 kDa) intracellular calcium-binding proteins that control key cellular pathways including regulation of the cytoskeleton, cell migration and adhesion, and host oxidative defense. S100A9 may exist as a homodimer, heterodimer (24 kDa) with an S100A8 partner (S100A8/A9), or as a heterotetramer (28 kDa) with an S100A8 partner(S100A8/A9). S100A8 and S100A9 are found intracellularly in granulocytes, monocytes, and early differentiation stages of macrophages. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2600 Product name: Recombinant Mouse S100a9 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 2-113 aa of NM_001281852.1 Sequence: ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK Predict reactive species Full Name: S100 calcium binding protein A9 (calgranulin B) Calculated Molecular Weight: 13 kDa GenBank Accession Number: NM_001281852.1 Gene Symbol: S100a9 Gene ID (NCBI): 20202 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P31725 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924