Iright
BRAND / VENDOR: Proteintech

Proteintech, 98507-2-RR, Anti-Human CEACAM8/CD66b Rabbit Recombinant Antibody

CATALOG NUMBER: 98507-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The CEACAM8/CD66b (98507-2-RR) by Proteintech is a Recombinant antibody targeting CEACAM8/CD66b in FC applications with reactivity to human samples 98507-2-RR targets CEACAM8/CD66b in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human peripheral blood leukocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8), also known as CD66b, CGM6 or NCA-95, is a member of the cacinoembryonic antigen (CEA) family which belongs to the immunoglobulin superfamily of cell adhesion molecules (PMID: 16919437). CEACAM8 is a glycosylphosphatidylinositol (GPI)-linked glycoprotein expressed on granulocytes (PMID: 8104998; 18056392). It is involved in regulating adhesion and activation of eosinophils (PMID: 18056392). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg32133 Product name: Recombinant Human CEACAM-8 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 35-319 aa of BC026263 Sequence: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS Predict reactive species Full Name: carcinoembryonic antigen-related cell adhesion molecule 8 Calculated Molecular Weight: 38 kDa GenBank Accession Number: BC026263 Gene Symbol: CEACAM8 Gene ID (NCBI): 1088 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P31997 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924