Iright
BRAND / VENDOR: Proteintech

Proteintech, 98509-6-RR, Anti-Mouse OLR1/LOX1 Rabbit Recombinant Antibody

CATALOG NUMBER: 98509-6-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The OLR1/LOX1 (98509-6-RR) by Proteintech is a Recombinant antibody targeting OLR1/LOX1 in FC applications with reactivity to mouse samples 98509-6-RR targets OLR1/LOX1 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: Transfected HEK-293T cells, RAW 264.7 cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information OLR1/LOX-1 acts as a receptor, in the form of homodimer, that mediates the recognition, internalization, and degradation of oxidatively modified low density lipoprotein (oxLDL) (PMID: 9052782, 15695803). OLR1/LOX1 is predominantly expressed in endothelial cells and vascular-rich organs such as the placenta, lung, liver, and brain (PMID: 9828121). Mouse OLR1/LOX1 is type II transmembrane protein containing 363 amino acids and has a cytoplasmic N-terminus and an extracellular C-terminus comprising the neck domain and the ligand-binding domain (CTLD) (PMID: 9588202). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2473 Product name: Recombinant Mouse OLR1/LOX1 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 60-363 aa of NM_138648.2 Sequence: RQVSDLLKQYQANLTQQDRILEGQMLAQQKAENTSQESKKELKGKIDTLTQKLNEKSKEQEELLQKNQNLQEALQRAANSSEESQRELKGKIDTITRKLDEKSKEQEELLQMIQNLQEALQRAANSSEESQRELKGKIDTLTLKLNEKSKEQEELLQKNQNLQEALQRAANFSGPCPQDWLWHKENCYLFHGPFSWEKNRQTCQSLGGQLLQINGADDLTFILQAISHTTSPFWIGLHRKKPGQPWLWENGTPLNFQFFKTRGVSLQLYSSGNCAYLQDGAVFAENCILIAFSICQKKTNHLQI Predict reactive species Full Name: oxidized low density lipoprotein (lectin-like) receptor 1 Calculated Molecular Weight: 42 kDa GenBank Accession Number: NM_138648.2 Gene Symbol: Olr1 Gene ID (NCBI): 108078 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9EQ09 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924