Proteintech, 98511-1-RR, Anti-Human DR4 Rabbit Recombinant Antibody

Size: 100ug The DR4 (98511-1-RR) by Proteintech is a Recombinant antibody targeting DR4 in FC applications with reactivity to human samples 98511-1-RR targets DR4 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: HEL92.1.7 Recommended dilution Flow Cytometry (FC): FC : 0.15 ug per 10^6 cells in a 100 µl suspension Background Information Tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL) is a member of the TNF superfamily. TRAIL activates apoptosis through the death receptors DR4 (also known as TRAILR1 and TNFRSF10A) and DR5 (also known as TRAILR2, KILLER and TNFRSF10B). DR4 and DR5 are single-pass type I membrane proteins that contain intracellular death domains (DD) and upon activation mediate apoptotic signals (PMID: 11163110). Binding of TRAIL to DR4 or DR5 results in receptor oligomerization and recruitment of FAS-associated protein with death domain (FADD) and caspase 8 to form a functional death-inducing signalling complex (DISC). Upon DISC formation, caspase 8 is cleaved and activated, which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis (PMID: 18813321). DR4 or DR5 promotes the activation of NF-kappa-B and play an important role in inflammation (PMID: 9430227, 19434100). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4600 Product name: Recombinant Human DR4 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 109-239 aa of BC012866 Sequence: ATIKLHDQSIGTQQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHN Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 10a Calculated Molecular Weight: 50 kDa GenBank Accession Number: BC012866 Gene Symbol: DR4 Gene ID (NCBI): 8797 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O00220 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.