Proteintech, 98512-2-RR, Anti-Human IL-20RA Rabbit Recombinant Antibody

Size: 100ug The IL-20RA (98512-2-RR) by Proteintech is a Recombinant antibody targeting IL-20RA in FC applications with reactivity to human samples 98512-2-RR targets IL-20RA in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: Transfected CHO cells, T-47D cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Interleukin 20 receptor subunit alpha (IL-20RA) belongs to the type II cytokine receptor family. Upon binding to its ligands, such as interleukin (IL)-19, IL-20, and IL-24, IL-20RA can form a functional heterodimeric receptor with IL-20RB. IL-26, another IL-20RA ligand, requires IL-20RA and interleukin 10 receptor subunit beta (IL-10RB) for signaling (PMID: 25421700; 11163236; 15178681). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2780 Product name: Recombinant Human IL-20RA protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 30-250 aa of NM_014432 Sequence: VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK Predict reactive species Full Name: interleukin 20 receptor, alpha Calculated Molecular Weight: 62 kDa GenBank Accession Number: NM_014432 Gene Symbol: IL20RA Gene ID (NCBI): 53832 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UHF4-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.