Proteintech, 98521-3-RR, Anti-Human BCAM Rabbit Recombinant Antibody

Size: 100ug The BCAM (98521-3-RR) by Proteintech is a Recombinant antibody targeting BCAM in FC applications with reactivity to human samples 98521-3-RR targets BCAM in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human peripheral blood erythrocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Basal cell adhesion molecule (Lu/BCAM) is a membrane-bound glycoprotein of the immunoglobulin superfamily (IgSF), functioning as a receptor for the extracellular matrix protein, laminin. BCAM (Lutheran/basal cell-adhesion molecule, a glycoprotein) belongs to the immunoglobulin superfamily which contains both Lu blood group and BCAM tumor-associated antigens. Proteomics analysis suggests that BCAM might be a potential biomarker for pancreatic cancer (PMID: 19199705). BCAM, involved in cell adhesion and migration, can also promote tumor metastasis and has been elucidated to play a functional role in the metastasis of thyroid cancer and gastric cancer (PMID: 10728810, 35941663). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2567 Product name: Recombinant Human BCAM protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 32-547 aa of BC050450 Sequence: EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQA Predict reactive species Full Name: basal cell adhesion molecule (Lutheran blood group) Calculated Molecular Weight: 67 kDa GenBank Accession Number: BC050450 Gene Symbol: BCAM Gene ID (NCBI): 4059 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P50895 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.