Proteintech, 98537-2-RR, Anti-Mouse CD107a / LAMP1 Rabbit Recombinant Antibody

Size: 100ug The CD107a / LAMP1 (98537-2-RR) by Proteintech is a Recombinant antibody targeting CD107a / LAMP1 in IF/ICC, IF-P, FC applications with reactivity to mouse samples 98537-2-RR targets CD107a / LAMP1 in IF/ICC, IF-P, FC applications and shows reactivity with mouse samples. Tested Applications Positive IF-P detected in: mouse liver tissue Positive IF/ICC detected in: C2C12 cells Positive FC detected in: mouse peritoneal macrophages Recommended dilution Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information LAMP1 (CD107a) is a heavily glycosylated membrane protein enriched in the lysosomal membrane. LAMP1 is extensively glycosylated with asparagine-linked oligosaccharides which protect it from intracellular proteolysis (PMID: 10521503). Although LAMP1 is expressed largely in the endosome-lysosomal membrane of cells, it is also found on the plasma membrane (PMID: 16168398). Elevated LAMP1 expression at the cell surface has also been detected during platelet and granulocytic cell activation, as well as in some tumor cells (PMID: 29085473). LAMP1 functions to provide selectins with carbohydrate ligands. This protein has also been shown to be a marker of degranulation on lymphocytes such as CD8+ and NK cells and may also play a role in tumor cell differentiation and metastasis (PMID: 18835598; 29085473; 9426697). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3858 Product name: Recombinant Mouse LAMP-1/CD107a protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 25-370 aa of NM_010684.3 Sequence: LFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNN Predict reactive species Full Name: lysosomal-associated membrane protein 1 Calculated Molecular Weight: 44 kDa GenBank Accession Number: NM_010684.3 Gene Symbol: CD107a Gene ID (NCBI): 16783 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P11438 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.