Proteintech, 98567-3-RR, Anti-Mouse IL-28B Rabbit Recombinant Antibody

Size: 100ug The IL-28B (98567-3-RR) by Proteintech is a Recombinant antibody targeting IL-28B in FC (Intra) applications with reactivity to mouse samples 98567-3-RR targets IL-28B in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information IL-28B is a type III IFN, which shares many of the biological effects of type I IFNs but may have fewer side effects due to a more selective receptor distribution. It interacts with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA) (PMID: 20712453;12469119;16539846). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3146 Product name: Recombinant Mouse IL-28B/ IFNL3 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 20-193 aa of NM_177396.1 Sequence: DPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKGAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENINDSALTTILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFQLLLRDLKCVASGDQCV Predict reactive species Full Name: interleukin 28B Calculated Molecular Weight: 22 kDa GenBank Accession Number: NM_177396.1 Gene Symbol: Il28b Gene ID (NCBI): 338374 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8CGK6 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.