Proteintech, 98582-1-RR, Anti-Human TNFSF12 Rabbit Recombinant Antibody

Size: 100ug The TNFSF12 (98582-1-RR) by Proteintech is a Recombinant antibody targeting TNFSF12 in FC applications with reactivity to human samples 98582-1-RR targets TNFSF12 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: Transfected CHO Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information TNFSF12, also known as TWEAK (TNF-like weak inducer of apoptosis), is a member of the tumor necrosis factor ligand superfamily. It functions as a cytokine by binding to its primary receptor, Fn14 (TNFRSF12A), and plays diverse roles in immune regulation, angiogenesis, tissue repair, and inflammation (PMID: 39905000). TNFSF12 is upregulated in multiple solid tumors and promotes cancer cell proliferation, invasion, migration, and epithelial-mesenchymal transition (EMT) (PMID: 28639899). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2870 Product name: Recombinant Human TNFSF12 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 93-249 aa of NM_003809.2 Sequence: RSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH Predict reactive species Full Name: tumor necrosis factor (ligand) superfamily, member 12 Calculated Molecular Weight: 27 kDa GenBank Accession Number: NM_003809.2 Gene Symbol: TNFSF12 Gene ID (NCBI): 8742 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O43508-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.