Iright
BRAND / VENDOR: Proteintech

Proteintech, 98597-1-RR, Anti-Mouse Dectin-1 Rabbit Recombinant Antibody

CATALOG NUMBER: 98597-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The Dectin-1 (98597-1-RR) by Proteintech is a Recombinant antibody targeting Dectin-1 in FC applications with reactivity to mouse samples 98597-1-RR targets Dectin-1 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse peritoneal macrophages Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Dectin-1, also known as CLEC7A or CD369, is a type II membrane receptor consisting of an extracellular C-terminal C-type lectin domain, a short stalk region, a single transmembrane domain and a short N-terminal cytoplasmic tail, which contains an immunoreceptor tyrosine-based activation motif (PMID: 10779524; 21612412). Dectin-1 is expressed on monocytes, macrophages, neutrophils, dendritic cells, and a subpopulation of T cells (PMID: 12244185). Dectin-1 plays a role in the innate immune response. It functions as a pattern-recognition receptor and recognizes a variety of β-glucans from fungi, plants, and bacteria. Dectin-1 may also participate in orchestrating the adaptive immune response (PMID: 21612412). The apparent molecular weight is larger than the calculated molecular weight due to glycosylation (PMID: 10779524). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2676 Product name: Recombinant Mouse Dectin-1 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 71-244 aa of / Sequence: GHNSGRNPEEKDNFLSRNKENHKPTESSLDEKVAPSKASQTTGGFSQPCLPNWIMHGKSCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEFIESQTSSHRINAFWIGLSRNQSEGPWFWEDGSAFFPNSFQVRNTAPQESLLHNCVWIHGSEVYNQICNTSSYSICEKEL Predict reactive species Full Name: C-type lectin domain family 7, member a Calculated Molecular Weight: 27 kDa GenBank Accession Number: / Gene Symbol: Clec7a Gene ID (NCBI): 56644 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6QLQ4 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924