Proteintech, 98607-1-RR, Anti-Human LILRA2/CD85h Rabbit Recombinant Antibody

Size: 100ug The LILRA2/CD85h (98607-1-RR) by Proteintech is a Recombinant antibody targeting LILRA2/CD85h in FC applications with reactivity to human samples 98607-1-RR targets LILRA2/CD85h in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: FC receptor blocked human peripheral blood leukocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information LILRA2 (Leukocyte Immunoglobulin-Like Receptor A2) is a specialized cell surface receptor primarily expressed on innate immune cells. It functions as a sensor for specific microbial products and plays a complex role in regulating immune responses. LILRA2 selectively modulates LPS-mediated responses in monocytes, enhancing production of specific pro-inflammatory cytokines while inhibiting phagocytosis (PMID 22479404). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1746 Product name: Recombinant Human LILRA2 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-449 aa of NM_001130917.3 Sequence: GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSEAAETLSPSQNKTDSTTTSLGQHPQDYTVEN Predict reactive species Full Name: leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2 Calculated Molecular Weight: 53kDa GenBank Accession Number: NM_001130917.3 Gene Symbol: LILRA2 Gene ID (NCBI): 11027 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8N149-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.