Proteintech, 98627-1-RR, Anti-Mouse LIGHT/CD258 Rabbit Recombinant Antibody

Size: 100ug The LIGHT/CD258 (98627-1-RR) by Proteintech is a Recombinant antibody targeting LIGHT/CD258 in FC applications with reactivity to mouse samples 98627-1-RR targets LIGHT/CD258 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: anti-CD3/CD28 treated mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information LIGHT, also known as TNFSF14, HVEML, or CD258, is a type II transmembrane protein that belongs to the TNF superfamily (PMID: 9462508). It is predominantly expressed in lymphoid tissues and produced by activated T cells and immature dendritic cells (DCs) (PMID: 9462508; 10754304). Through its two primary functional receptors HVEM (TNFRSF14) and lymphotoxin β receptor (LTβR), LIGHT signaling is involved in development and maintenance of lymphoid tissues, as well as innate and adaptive immune responses (PMID: 24575096; 26720335). In addition to the membrane form, LIGHT can also exist as a soluble form generated by cleavage of the extracellular portion of the membrane form. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2654 Product name: Recombinant Mouse LIGHT/CD258 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 72-239 aa of NM_019418.3 Sequence: DGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV Predict reactive species Full Name: tumor necrosis factor (ligand) superfamily, member 14 Calculated Molecular Weight: 26 kDa GenBank Accession Number: NM_019418.3 Gene Symbol: Tnfsf14 Gene ID (NCBI): 50930 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9QYH9 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.