Proteintech, 98631-2-RR, Anti-Human FGFR3 Rabbit Recombinant Antibody

Size: 100ug The FGFR3 (98631-2-RR) by Proteintech is a Recombinant antibody targeting FGFR3 in FC applications with reactivity to human samples 98631-2-RR targets FGFR3 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: K562 cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Fibroblast growth factors (FGFs) are polypeptide growth factors involved in a variety of activities including mitogenesis, angiogenesis, and wound healing (PMID: 1847508). The human FGF receptor family, a subfamily of receptor tyrosine kinases (RTKs), comprises of four family members-FGFR1, FGFR2, FGFR3, and FGFR4 (PMID: 23900974). Each receptor contains an extracellular domain with either two or three immunoglobulin-like domains, a transmembrane domain, and a cytoplasmic tyrosine kinase domain. FGFR3 binds acidic and basic fibroblast GH and plays a role in bone development and maintenance. Mutations in the FGFR3 gene lead to craniosynostosis and multiple types of skeletal dysplasia. Due to frequent mutations in certain cancers, the FGFR3 gene has also been associated with tumor progression. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1040 Product name: Recombinant Human FGFR3(IIIc) protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 23-375 aa of Sequence: ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG Predict reactive species Full Name: fibroblast growth factor receptor 3 Calculated Molecular Weight: 88kd Gene Symbol: FGFR3 Gene ID (NCBI): 2261 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P22607-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.