Iright
BRAND / VENDOR: Proteintech

Proteintech, 98648-3-RR, Anti-Sheep CD14 Rabbit Recombinant Antibody

CATALOG NUMBER: 98648-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The CD14 (98648-3-RR) by Proteintech is a Recombinant antibody targeting CD14 in FC applications with reactivity to sheep samples 98648-3-RR targets CD14 in FC applications and shows reactivity with sheep samples. Tested Applications Positive FC detected in: sheep PBMCs cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD14 is a 50-55 kDa glycosylphosphatidylinositol-anchored glycoprotein preferentially expressed on monocytes and macrophages, and at lower levels on granulocytes (PMID: 3385210; 2462937; 7685797). CD14 can also exist as a soluble protein. CD14 acts as a co-receptor for bacterial liposaccharides (LPS) (PMID: 1698311). It plays a major role in the inflammatory response of monocytes to LPS. Specification Tested Reactivity: sheep Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg6924 Product name: Recombinant sheep CD14 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 21-373 aa of NM_001077209.1 Sequence: DTTEPCELDDDDFRCVCNFTDPKPDWSSAVQCMVAVEVEIRGGGHSLDQFLKGVNTDPKQYADTIKALRVRRLKLGAAQVPAQLLVAVLRALGYSRLKELTLEDLEVTGPTPPTPLEATGPALTTLSLRNVSWATGGAWLGELQQWLKPGLRALNIAQAHSLAFPCAGLSTFEALTTLDLSDNPSLGDSGLMAALCPNKFPALQYLALRNAGMETPSGVCAALAAARVQPQSLDLSHNSLRVTAPGATRCVWPSALSSLNLSFAGLEQVPKGLPTKLSVLDLSCNKLSREPRREELPEVNVLTLDGNPFLDPGALKHQDDPMISGVVPACARSALTMGVSGTLALLQGARGFA Predict reactive species Full Name: CD14 molecule Calculated Molecular Weight: 40 kDa GenBank Accession Number: NM_001077209.1 Gene Symbol: CD14 Gene ID (NCBI): 443216 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q06AV9 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924