Proteintech, 98665-1-RR, Anti-Human GPR37 Rabbit Recombinant Antibody

Size: 100ug The GPR37 (98665-1-RR) by Proteintech is a Recombinant antibody targeting GPR37 in FC applications with reactivity to human samples 98665-1-RR targets GPR37 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: THP-1 cells, A172 cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information The orphan G protein-coupled receptor GPR37, also known as PAELR (parkin-associated endothelin receptor-like receptor) or ETBR-LP-1 (endothelin B receptor-like protein 1), is a 613 aa, multi-pass membrane protein predominantly expressed in the brain. It is a substrate of parkin (PARK2). When overexpressed in cells, GPR37 tends to become insoluble, unfolded, and ubiquitinated in vivo. Accumulation of the unfolded protein may lead to dopaminergic neuronal death in juvenile Parkinson disease (JPD). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5426 Product name: Recombinant human GPR37 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 27-265 aa of NM_005302.5 Sequence: ALGVAPASRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAVM Predict reactive species Full Name: G protein-coupled receptor 37 (endothelin receptor type B-like) Calculated Molecular Weight: 67 kDa GenBank Accession Number: NM_005302.5 Gene Symbol: GPR37 Gene ID (NCBI): 2861 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O15354 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.