Iright
BRAND / VENDOR: Proteintech

Proteintech, 98674-2-RR, Anti-Human ADAM17 Rabbit Recombinant Antibody

CATALOG NUMBER: 98674-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The ADAM17 (98674-2-RR) by Proteintech is a Recombinant antibody targeting ADAM17 in FC applications with reactivity to human samples 98674-2-RR targets ADAM17 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information The ADAMs (A Disintegrin And Metalloprotease) are multidomain transmembrane proteins. One of the first ADAMs implicated in membrane shedding is ADAM-17, which is shown to release the active form of tumor necrosis factor (TNF)-a from its precursor (PMID:18238782). ADAM17 mediates the release of pro-inflammatory cytokines and modulates cell signaling pathways involved in tumor progression and metastasis (PMID:17438092). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4732 Product name: Recombinant Human ADAM17 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 470-570 aa of NM_003183.5 Sequence: FQERSNKVCGNSRVDEGEECDPGIMYLNNDTCCNSDCTLKEGVQCSDRNSPCCKNCQFETAQKKCQEAINATCKGVSYCTGNSSECPPPGNAEDDTVCLDL Predict reactive species Full Name: ADAM metallopeptidase domain 17 Calculated Molecular Weight: 93 kDa GenBank Accession Number: NM_003183.5 Gene Symbol: ADAM17 Gene ID (NCBI): 6868 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P78536-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924