Iright
BRAND / VENDOR: Proteintech

Proteintech, 98677-3-RR, Anti-Human TMEM119 Rabbit Recombinant Antibody

CATALOG NUMBER: 98677-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The TMEM119 (98677-3-RR) by Proteintech is a Recombinant antibody targeting TMEM119 in FC applications with reactivity to human samples 98677-3-RR targets TMEM119 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: SH-SY5Y cells, Transfected CHO-K1 Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information TMEM119 (Transmembrane Protein 119), also known as OBIF (Osteoblast Induction Factor), is a type I transmembrane protein that serves as a highly specific marker for resident microglia in the central nervous system (CNS). TMEM119 immunohistochemistry might provide a useful tool for investigating the biology and pathology of human microglia(PMID: 26250788). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1823 Product name: Recombinant human TMEM119 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-96 aa of NM_181724 Sequence: RSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQPITLGGPSPPTNFLDGIVDFFRQYVM Predict reactive species Full Name: transmembrane protein 119 Calculated Molecular Weight: 29kd GenBank Accession Number: NM_181724 Gene Symbol: TMEM119 Gene ID (NCBI): 338773 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q4V9L6 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924