Iright
BRAND / VENDOR: Proteintech

Proteintech, 98688-2-RR, Anti-Mouse CD367/CLEC4A Rabbit Recombinant Antibody

CATALOG NUMBER: 98688-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The CD367/CLEC4A (98688-2-RR) by Proteintech is a Recombinant antibody targeting CD367/CLEC4A in FC applications with reactivity to mouse samples 98688-2-RR targets CD367/CLEC4A in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse bone marrow cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CLEC4A (also commonly referred to as DCIR) belongs to the C-type lectin receptor (CLR) family and functions primarily as an inhibitory receptor in the immune system. It is a type II transmembrane protein containing a C-type lectin-like domain (CTLD). Uniquely among most CLRs, it possesses an immunoreceptor tyrosine-based inhibitory motif (ITIM) in its cytoplasmic tail (PMID: 35017526). Mice lacking Clec4a2 or Clec4a4 are highly susceptible to autoimmune conditions such as experimental arthritis and experimental autoimmune encephalomyelitis (EAE) due to excessive DC activation (PMID: 27068492). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5258 Product name: recombinant mouse CD367/Clec4a protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 70-238 aa of NM_001170332.1 Sequence: QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL Predict reactive species Full Name: C-type lectin domain family 4, member a2 Calculated Molecular Weight: 27 kDa GenBank Accession Number: NM_001170332.1 Gene Symbol: Clec4a2 Gene ID (NCBI): 26888 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9QZ15 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924