Iright
BRAND / VENDOR: Proteintech

Proteintech, 98700-1-RR, Anti-Pig CD8b Rabbit Recombinant Antibody

CATALOG NUMBER: 98700-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The CD8b (98700-1-RR) by Proteintech is a Recombinant antibody targeting CD8b in FC applications with reactivity to pig samples 98700-1-RR targets CD8b in FC applications and shows reactivity with pig samples. Tested Applications Positive FC detected in: pig PBMCs Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD8b (T-cell surface glycoprotein CD8 beta chain) is an integral membrane glycoprotein that forms disulfide-linked heterodimers with CD8a (CD8 alpha chain). The CD8 alpha/beta heterodimer is the predominant CD8 complex expressed on the cell surface (PMID: 1534146; 2111591). CD8 is a transmembrane glycoprotein predominantly expressed on the surface of cytotoxic T cells and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells. Specification Tested Reactivity: pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg7161 Product name: Recombinant pig CD8B protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-168 aa of / Sequence: LLQTPSSVMAQTNQTVKLSCEARTFPTNTRIYWLRLRQAPSANSHYEFLALWIPNGNPVYGKETEKQLTVLQDSSRYLLQLRHVKPADSGNYFCMAVGNPELTFGKGTRLSVVDVFPTTAQPTKKTRPKKKICRLPNLVPPKGPACAP Predict reactive species Full Name: CD8 subunit beta Calculated Molecular Weight: 23 kDa GenBank Accession Number: / Gene Symbol: CD8b Gene ID (NCBI): 396636 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: F1SVD7 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924