Proteintech, 98714-2-RR, Anti-Pig CD19 Rabbit Recombinant Antibody

Size: 100ug The CD19 (98714-2-RR) by Proteintech is a Recombinant antibody targeting CD19 in FC applications with reactivity to pig samples 98714-2-RR targets CD19 in FC applications and shows reactivity with pig samples. Tested Applications Positive FC detected in: pig PBMCs Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD19 is a type I transmembrane glycoprotein belonging to the immunoglobulin superfamily (PMID: 2472450). It is expressed by B cells and follicular dendritic cells. CD19 is up-regulated at the step of B-lineage commitment during the differentiation of the hematopoietic stem cell, it remains on during subsequent stages of differentiation until finally down-regulated during terminal differentiation into plasma cells (PMID: 8528044). CD19 is involved in B cell development, activation and differentiation. It is the dominant component for the signaling complex on B cells that includes CD21 (CR2), CD81 (TAPA-1) and CD225 and acts as a critical co-receptor for BCR signal transduction (PMID: 23210908). Specification Tested Reactivity: pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg7132 Product name: Recombinant pig CD19 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 23-304 aa of XM_013995590.1 Sequence: RPQEPYLVEAQEGGNAVLPCLEGPSEGPPEQLAWFRGSQSTPFLELSLGLPGLGIHVGPLGTLKEPQGTLLFIFNVSDQMGGFYLCQQGPPLDQSWQPGWTVNVKGSGELFRWNASDLNDPSCDLGARSSEGRRSSSSHPTRSKLYVWAKNQAKVLHTDLTCPPPNSTVNQSNSHDLTVAPGSTLSLSCGSSRASLVRGPISWIHVRPKKHVKLLSLNLTEDAQLREMWVMGSLRGKAVLLLPEATAQDADTYHCNHGNVTTQMRLKVTARSVWHWLLETGG Predict reactive species Full Name: CD19 molecule Calculated Molecular Weight: 63 kDa GenBank Accession Number: XM_013995590.1 Gene Symbol: CD19 Gene ID (NCBI): 397669 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: A0A8D0M7A3 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.