Product Description
Size: 100ug
The IL-1 alpha (98732-2-RR) by Proteintech is a Recombinant antibody targeting IL-1 alpha in FC applications with reactivity to rat samples
98732-2-RR targets IL-1 alpha in FC applications and shows reactivity with rat samples.
Tested Applications
Positive FC detected in: Transfected HEK-293T cells
Recommended dilution
Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension
Specification
Tested Reactivity: rat
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Eg4641 Product name: Recombinant Rat IL-1 alpha protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 115-270 aa of NM_017019.1 Sequence: SAPHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS Predict reactive species
Full Name: interleukin 1 alpha
Calculated Molecular Weight: 31kDa
GenBank Accession Number: NM_017019.1
Gene Symbol: Il1a
Gene ID (NCBI): 24493
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P16598
Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924