Iright
BRAND / VENDOR: Proteintech

Proteintech, 98762-1-RR, Anti-Sheep CD4 Rabbit Recombinant Antibody

CATALOG NUMBER: 98762-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The CD4 (98762-1-RR) by Proteintech is a Recombinant antibody targeting CD4 in FC applications with reactivity to sheep samples 98762-1-RR targets CD4 in FC applications and shows reactivity with sheep samples. Tested Applications Positive FC detected in: sheep PBMCs Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD4 is a 55-kDa transmembrane glycoprotein expressed on T helper cells, majority of thymocytes, monocytes, macrophages, and dendritic cells (PMID: 9304802; 12213222). CD4 is an accessory protein for MHC class-II antigen/T-cell receptor interaction. It plays an important role in T helper cell development and activation (PMID: 9539765; 3112582). CD4 serves as a receptor for the human immunodeficiency virus (HIV) (PMID: 9304802). Specification Tested Reactivity: sheep Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg6925 Product name: Recombinant sheep CD4 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 26-390 aa of 443509 Sequence: KAVVLGKAGGQAELPCQASQKKNIVFSWKDSSQSKILGSHNSFLHKGNTELSHRVESKKNLWDQGSFPLIIKNLQVTDSGTYTCEVDSKKLEVELKVFGLTASSDTRVLLGQSLTLTLESPSGSNPSVQWKGPGNNRKEELKSLSLAQVGLQDSGTWTCTISQSQQTLEIKIPIVVLAFQKAPETVYVKEGEQAEFSFPLTFEDENLSGELTWQQANKDSSSQSWVTFTLRNREVKVNKTHKDVKLHMGERLPLRLTLQRTLPQYAGSGTLTLDLTKGKLHQKVNLVVMTVTKSPNSLTCEVLGPSPPRLTLNLKLGNQSMKSSNQPKVVTELEPKAGMWQCLLSDQGKVLLESKIEVLPSEFIQ Predict reactive species Full Name: CD4 molecule Calculated Molecular Weight: 50 kDa GenBank Accession Number: 443509 Gene Symbol: CD4 Gene ID (NCBI): 443509 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: A0A6P3CX46 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924