Iright
BRAND / VENDOR: Proteintech

Proteintech, APC-FcA98063, FcZero-rAb™ APC Anti-Human LIGHT/CD258 Rabbit Recombinant Antibody

CATALOG NUMBER: APC-FcA98063
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100tests The LIGHT/CD258 (APC-FcA98063) by Proteintech is a Recombinant antibody targeting LIGHT/CD258 in FC applications with reactivity to human samples APC-FcA98063 targets LIGHT/CD258 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: PMA, Ionomycin treated human PBMCs Recommended dilution Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension Background Information LIGHT, also known as TNFSF14, HVEML, or CD258, is a type II transmembrane protein that belongs to the TNF superfamily (PMID: 9462508). It is predominantly expressed in lymphoid tissues and produced by activated T cells and immature dendritic cells (DCs) (PMID: 9462508; 10754304). Through its two primary functional receptors HVEM (TNFRSF14) and lymphotoxin β receptor (LTβR), LIGHT signaling is involved in development and maintenance of lymphoid tissues, as well as innate and adaptive immune responses (PMID: 24575096; 26720335). In addition to the membrane form, LIGHT can also exist as a soluble form generated by cleavage of the extracellular portion of the membrane form. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg32095 Product name: Recombinant Human LIGHT/CD258 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: N-6*his Domain: 74-240 aa of NM_003807 Sequence: DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV Predict reactive species Full Name: tumor necrosis factor (ligand) superfamily, member 14 Calculated Molecular Weight: 26KD GenBank Accession Number: NM_003807 Gene Symbol: LIGHT Gene ID (NCBI): 8740 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: O43557 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924