Proteintech, APC-FcA98125, FcZero-rAb™ APC Anti-Human TWEAKR/CD266 Rabbit Recombinant Antibody

Size: 100tests The TWEAKR/CD266 (APC-FcA98125) by Proteintech is a Recombinant antibody targeting TWEAKR/CD266 in FC applications with reactivity to human samples APC-FcA98125 targets TWEAKR/CD266 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: HT-1080 cells Recommended dilution Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension Background Information TWEAKR (also known as CD266, FN14, TNFRSF12A) is a member of the TNF receptor superfamily which is activated by its ligand, the cytokine TWEAK (TNFSF12). TWEAKR is the smallest member of the TNFR superfamily. TWEAKR was first described as an FGF-inducible gene that played a role in fibroblast adhesion and migration. Subsequently, the induction of TWEAKR expression by other growth factors and/or upon tissue injury was observed in multiple cell types, including hepatocytes, endothelial cells, adipocytes, and cardiomyocytes. (PMID: 23073510, PMID: 24409185) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13823 Product name: Recombinant human TWEAKR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-91 aa of BC002718 Sequence: LALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFV Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 12A Calculated Molecular Weight: 129 aa, 14 kDa GenBank Accession Number: BC002718 Gene Symbol: TWEAKR Gene ID (NCBI): 51330 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NP84 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.