Iright
BRAND / VENDOR: Proteintech

Proteintech, APC-FcA98135, FcZero-rAb™ APC Anti-Mouse Fas/CD95 Rabbit Recombinant Antibody

CATALOG NUMBER: APC-FcA98135
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The Fas/CD95 (APC-FcA98135) by Proteintech is a Recombinant antibody targeting Fas/CD95 in FC applications with reactivity to mouse samples APC-FcA98135 targets Fas/CD95 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse thymocytes Recommended dilution Flow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension Background Information Fas (CD95/APO-1) is a transmembrane glycoprotein belonging to the tumor necrosis factor (TNF) receptor superfamily. It can mediate apoptosis by ligation with an agonistic anti-Fas antibody or Fas ligand. Stimulation of Fas results in the aggregation of its intracellular death domains, leading to the formation of the death-inducing signaling complex (DISC). FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The molecular mass of native Fas is 38 kDa, the high molecular weight form (40-55 kDa) of Fas is due to glycosylation. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1376 Product name: Recombinant Mouse Fas/CD95 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-169 aa of NM_007987.2 Sequence: QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNR Predict reactive species Full Name: Fas (TNF receptor superfamily member 6) Calculated Molecular Weight: 37kDa GenBank Accession Number: NM_007987.2 Gene Symbol: Fas/CD95 Gene ID (NCBI): 14102 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: P25446 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924