Proteintech, APC-FcA98152, FcZero-rAb™ APC Anti-Mouse CD138/Syndecan-1 Rabbit Recombinant Antibody

Size: 100ug The CD138/Syndecan-1 (APC-FcA98152) by Proteintech is a Recombinant antibody targeting CD138/Syndecan-1 in FC applications with reactivity to mouse samples APC-FcA98152 targets CD138/Syndecan-1 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse bone marrow cells Recommended dilution Flow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension Background Information CD138, also named as Syndecan-1 (SDC1), is an integral membrane protein. It participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. It is a heparan sulfate proteoglycan expressed on the surface of, and actively shed by, myeloma cells. Altered syndecan-1 expression has been detected in several different tumor types. CD138 was regarded as a useful marker for labeling normal and neoplastic plasma cells and plasmacytoid lymphomas. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1221 Product name: Recombinant Mouse CD138/Syndecan-1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 23-252 aa of NM_011519.2 Sequence: QIVAVNVPPEDQDGSGDDSDNFSGSGTGALPDTLSRQTPSTWKDVWLLTATPTAPEPTSSNTETAFTSVLPAGEKPEEGEPVLHVEAEPGFTARDKEKEVTTRPRETVQLPITQRASTVRVTTAQAAVTSHPHGGMQPGLHETSAPTAPGQPDHQPPRVEGGGTSVIKEVVEDGTANQLPAGEGSGEQDFTFETSGENTAVAAVEPGLRNQPPVDEGATGASQSLLDRKE Predict reactive species Full Name: syndecan 1 Calculated Molecular Weight: 33 kDa GenBank Accession Number: NM_011519.2 Gene Symbol: Sdc1 Gene ID (NCBI): 20969 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: P18828-1 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.