Proteintech, APC-FcA98284, FcZero-rAb™ APC Anti-Mouse Ly-6G Rabbit Recombinant Antibody

Size: 100ug The Ly-6G (APC-FcA98284) by Proteintech is a Recombinant antibody targeting Ly-6G in FC applications with reactivity to mouse samples APC-FcA98284 targets Ly-6G in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse bone marrow cells Recommended dilution Flow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension Background Information Ly-6G (lymphocyte antigen 6 complex, locus G), also known as Gr-1, is a 21-25 kDa, glycosylphosphatidylinositol-anchored protein expressed on myeloid lineage cells in mouse bone marrow (PMID: 8360469). The expression of Ly-6G increases on neutrophils as they differentiate from immature cells in the bone marrow to mature cells in the blood and spleen (PMID: 8890901). This antibody specifically recognizes Ly-6G, but not Ly-6C. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2609 Product name: Recombinant Mouse Ly-6G protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 21-114 aa of NM_001310438.1 Sequence: AERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSS Predict reactive species Full Name: lymphocyte antigen 6 complex, locus G Calculated Molecular Weight: 14 kDa GenBank Accession Number: NM_001310438.1 Gene Symbol: Ly-6G Gene ID (NCBI): 546644 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Excitation Laser: Red Laser (633 nm) Form: Liquid Purification Method: Protein A purification UNIPROT ID: P35461 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.