Iright
BRAND / VENDOR: Proteintech

Proteintech, APC-FcA98416, FcZero-rAb™ APC Anti-Human Siglec-6/CD327 Rabbit Recombinant Antibody

CATALOG NUMBER: APC-FcA98416
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100tests The Siglec-6/CD327 (APC-FcA98416) by Proteintech is a Recombinant antibody targeting Siglec-6/CD327 in FC applications with reactivity to human samples APC-FcA98416 targets Siglec-6/CD327 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension Background Information Siglec-6, also known as CD327, originally identified on trophoblast cells of the placenta, is highly and consistently expressed on MCs from both mucosal and non-mucosal sites. Siglec-6 consists of 3 extracellular immunoglobulin (Ig) domains and 2 intracellular immunoreceptor tyrosine-based inhibition motifs (ITIMs), closely resembling the molecular structure of Siglec-3 (CD33) (PMID: 34289026). Siglec-6 was recruited to placental expression during human evolution, presumably to interact with sialylated ligands for specific negative signaling functions and/or to regulate leptin availability (PMID: 17580316). Siglec-6 is an immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing receptor selectively expressed by mast cells, making it a promising target for therapeutic intervention (PMID: 35406705). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2070 Product name: Recombinant Human Siglec-6 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 16-320 aa of BC035359 Sequence: QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSSFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGV Predict reactive species Full Name: sialic acid binding Ig-like lectin 6 Calculated Molecular Weight: 426 aa, 47 kDa GenBank Accession Number: BC035359 Gene Symbol: SIGLEC6 Gene ID (NCBI): 946 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: O43699 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924