Iright
BRAND / VENDOR: Proteintech

Proteintech, Biotin-FcA98039, FcZero-rAb™ Biotin Anti-Mouse CD200 Rabbit Recombinant Antibody

CATALOG NUMBER: Biotin-FcA98039
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The CD200 (Biotin-FcA98039) by Proteintech is a Recombinant antibody targeting CD200 in FC, ELISA applications with reactivity to mouse samples Biotin-FcA98039 targets CD200 in FC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD200, also known as OX2, is a type I transmembrane glycoprotein that belongs to the immunoglobulin superfamily (PMID: 3032785). It contains two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. CD200 is expressed on a variety of cell types, including thymocytes, B lymphocytes, a subset of T lymphocytes, follicular dendritic cells, neurons, and endothelial cells (PMID: 3032785; 10981966). CD200 binds to its receptor, CD200R, which is primarily expressed by myeloid and T cell lineage (PMID: 15187158). The CD200-CD200R interaction plays a role in immunosuppression and suppression of anti-tumor immune responses (PMID: 22020332). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0920 Product name: Recombinant mouse CD200 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 31-232 aa of / Sequence: QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG Predict reactive species Full Name: CD200 antigen Calculated Molecular Weight: 31 kDa GenBank Accession Number: / Gene Symbol: Cd200 Gene ID (NCBI): 17470 Conjugate: Biotin Excitation/Emission Maxima Wavelengths: - Form: Liquid Purification Method: Protein A purification UNIPROT ID: O54901 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924