Iright
BRAND / VENDOR: Proteintech

Proteintech, Biotin-FcA98057, FcZero-rAb™ Biotin Anti-Human CD126/IL-6R alpha Rabbit Recombinant Antibody

CATALOG NUMBER: Biotin-FcA98057
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The CD126/IL-6R alpha (Biotin-FcA98057) by Proteintech is a Recombinant antibody targeting CD126/IL-6R alpha in FC, ELISA applications with reactivity to human samples Biotin-FcA98057 targets CD126/IL-6R alpha in FC, ELISA applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Interleukin-6 (IL-6) is a pleiotropic cytokine produced by a variety of cells during infection, trauma, and immunological challenge (PMID: 8274730). IL-6 acts via a receptor complex consisting of two distinct membrane-bound glycoproteins, an 80-kDa IL-6-binding subunit (IL-6R alpha, CD126, gp80) and a 130-kDa signal-transducing element (gp130, CD130). After binding of IL-6 to membrane-bound IL-6R alpha, the complex of IL-6 and IL-6R alpha associates with gp130, thus activating the receptor (PMID: 9716487). Expression of gp130 is found in almost all organs while expression of IL-6R alpha is predominantly confined to hepatocytes and leukocyte subpopulations (monocytes, neutrophils, T cells, and B cells) (PMID: 11149892). Soluble form of IL-6R alpha has been found in human serum and urine (PMID: 2529343; 1545125). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0490 Product name: Recombinant Human CD126/IL-6R alpha protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-365 aa of BC132684 Sequence: LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP Predict reactive species Full Name: interleukin 6 receptor Calculated Molecular Weight: 468 aa, 52 kDa GenBank Accession Number: BC132684 Gene Symbol: IL-6R alpha Gene ID (NCBI): 3570 Conjugate: Biotin Excitation/Emission Maxima Wavelengths: - Form: Liquid Purification Method: Protein A purification UNIPROT ID: P08887 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924