Iright
BRAND / VENDOR: Proteintech

Proteintech, Biotin-FcA98213, FcZero-rAb™ Biotin Anti-Mouse CD157 Rabbit Recombinant Antibody

CATALOG NUMBER: Biotin-FcA98213
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The CD157 (Biotin-FcA98213) by Proteintech is a Recombinant antibody targeting CD157 in FC, ELISA applications with reactivity to mouse samples Biotin-FcA98213 targets CD157 in FC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD157, also known as bone marrow stromal cell antigen 1 (BST-1), or ADP-ribosyl cyclase 2, is a glycosyl phosphotidylinositol-anchored protein that stimulates pre-B-cell growth and has adenosine diphosphate (ADP)-ribosyl cyclase and cyclic ADP-ribose (cADPR) hydrolase activity (PMID: 9473467, 11866528). The two enzymatic activities are responsible for the synthesis and hydrolysis of cADPR, a novel second messenger of calcium release from intracellular calcium stores. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1528 Product name: Recombinant Mouse CD157 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 25-286 aa of Sequence: ARARWRGEGTTPHLQSIFLGRCAEYTTLLSLGNKNCTAIWEAFKGVLDKDPCSVLPSDYDLFINLSRHPIPRDKSLFWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCPTSEDCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFADFEIPYLQKDKVTRIEIWVMHDVGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDCIMNSASASMRRES Predict reactive species Full Name: bone marrow stromal cell antigen 1 Calculated Molecular Weight: 35kDa Gene Symbol: Bst1 Gene ID (NCBI): 12182 Conjugate: Biotin Excitation/Emission Maxima Wavelengths: - Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q64277 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924