Iright
BRAND / VENDOR: Proteintech

Proteintech, Biotin-FcA98340, FcZero-rAb™ Biotin Anti-Human NKp46/NCR1 Rabbit Recombinant Antibody

CATALOG NUMBER: Biotin-FcA98340
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The NKp46/NCR1 (Biotin-FcA98340) by Proteintech is a Recombinant antibody targeting NKp46/NCR1 in FC, ELISA applications with reactivity to human samples Biotin-FcA98340 targets NKp46/NCR1 in FC, ELISA applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information NKp46, also known as NCR1 or CD335, is an Ig-like superfamily cell surface receptor that is highly conserved in mammals (PMID: 22021440). NKp46 is a type I transmembrane glycoprotein consisting of two extracellular Ig-like domains, a transmembrane domain, and an intracellular tail (PMID: 9730896). It is expressed on NK cells, rare T-cell subsets and a mucosal population of NKp46+ innate lymphoid cells (PMID: 9730896; 22021440). NKp46 is the major triggering receptor involved in the natural cytotoxicity (PMID: 10359120; 10092106; 15356098). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1364 Product name: Recombinant Human NKp46/NCR1 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-258 aa of / Sequence: QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLR Predict reactive species Full Name: natural cytotoxicity triggering receptor 1 Calculated Molecular Weight: 34kDa GenBank Accession Number: / Gene Symbol: NCR1 Gene ID (NCBI): 9437 Conjugate: Biotin Excitation/Emission Maxima Wavelengths: - Form: Liquid Purification Method: Protein A purification UNIPROT ID: O76036-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924