Proteintech, Biotin-FcA98370-2, FcZero-rAb™ Biotin Anti-Human Glycophorin A/CD235a Rabbit Recombinant Antibody

Size: 100ug The Glycophorin A/CD235a (Biotin-FcA98370-2) by Proteintech is a Recombinant antibody targeting Glycophorin A/CD235a in FC, ELISA applications with reactivity to human samples Biotin-FcA98370-2 targets Glycophorin A/CD235a in FC, ELISA applications and shows reactivity with human samples. Tested Applications Positive FC detected in: Human peripheral blood erythrocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Glycophorin A (GYPA) is the major transmembrane sialoglycoprotein in erythrocytes. It is a dimeric type I transmembrane protein carrying 15 closely clustered O-linked tetrasaccharides capped with sialic acid/N-acetylneuraminic acid (Neu5Ac). This 36 kDa protein represents the major sialoglycoprotein of the red blood cell membrane displaying about one million copies per cell. (PMID: 9490702) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2336 Product name: Recombinant Human Glycophorin A protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-91 aa of BC005319 Sequence: SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE Predict reactive species Full Name: glycophorin A (MNS blood group) Calculated Molecular Weight: 150 aa, 16 kDa GenBank Accession Number: BC005319 Gene Symbol: Glycophorin A Gene ID (NCBI): 2993 Conjugate: Biotin Excitation/Emission Maxima Wavelengths: - Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02724 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.