Proteintech, Biotin-SF98202, Biotin Anti-Human CD81 Rabbit scFv Antibody

Size: 100ug The CD81 (Biotin-SF98202) by Proteintech is a Recombinant antibody targeting CD81 in FC, ELISA applications with reactivity to human samples Biotin-SF98202 targets CD81 in FC, ELISA applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 1:500-1:2000 Background Information CD81 (also known as TAPA1 or TSPAN28) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD81 is involved in signal transduction and cell adhesion in the immune system (PMID: 9597125). CD81 has also been identified as an essential receptor for HCV (hepatitis C virus) (PMID: 21428934). Specification Tested Reactivity: human Host / Type: Rabbit / scFv Class: Recombinant Type: Single-chain variable fragment antibody (scFv) Immunogen: CatNo: Eg1036 Product name: recombinant human CD81 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 113-201 aa of NM_004356.4 Sequence: FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK Predict reactive species Full Name: CD81 molecule Calculated Molecular Weight: 26 kDa GenBank Accession Number: NM_004356.4 Gene Symbol: CD81 Gene ID (NCBI): 975 ENSEMBL Gene ID: ENSG00000110651 Conjugate: Biotin Excitation/Emission Maxima Wavelengths: - Source: Anti-Human CD81 scFv from clone 241722G4, consisting of VH-GGGGS linker-VL (N- to C-terminus), with His tag at the C-terminus. Form: Liquid Purification Method: Affinity purification Storage Buffer: PBS with 4% sucrose and 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.