Product Description
Size: 100ug
The CD63 (Biotin-SF98318) by Proteintech is a Recombinant antibody targeting CD63 in FC applications with reactivity to human samples
Biotin-SF98318 targets CD63 in FC applications and shows reactivity with human samples.
Tested Applications
Positive FC detected in: Thrombin treated human peripheral blood platelets
Recommended dilution
Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension
Background Information
CD63 is a 30-60 kDa lysosomal membrane protein that belongs to the tetraspanin family. This protein plays many important roles in immuno-physiological functions. It mediates signal transduction events that regulate cell development, activation, growth, and motility. CD63 is expressed on activated platelets, thus it may function as a blood platelet activation marker. CD63 is a lysosomal membrane glycoprotein translocated to the plasma membrane after platelet activation. The CD63 tetraspanin is highly expressed in the early stages of melanoma and decreases in advanced lesions, suggesting it is a possible suppressor of tumor progression. Deficiency of this protein is associated with Hermansky-Pudlak syndrome.
Specification
Tested Reactivity: human
Host / Type: Rabbit / IgG
Class: Recombinant
Type: Single-chain variable fragment antibody (scFv)
Immunogen: CatNo: Eg2064 Product name: Recombinant Human CD63 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 103-203 aa of BC002349 Sequence: AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV Predict reactive species
Full Name: CD63 molecule
Calculated Molecular Weight: 26 kDa
GenBank Accession Number: BC002349
Gene Symbol: CD63
Gene ID (NCBI): 967
Conjugate: Biotin
Excitation/Emission Maxima Wavelengths: -
Source: Anti-Human CD63 scFv from clone 241964E1, consisting of VH-GGGGS linker-VL (N- to C-terminus), with His tag at the C-terminus.
Form: Liquid
Purification Method: Affinity purification
Storage Buffer: PBS with 4% sucrose and 0.09% sodium azide, pH 7.3.
Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924