Product Description
Size: 100ug
The CD90 (CL488-FcA98162) by Proteintech is a Recombinant antibody targeting CD90 in FC applications with reactivity to rat samples
CL488-FcA98162 targets CD90 in FC applications and shows reactivity with rat samples.
Tested Applications
Positive FC detected in: rat thymocytes
Recommended dilution
Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension
Background Information
CD90 (Thy-1) is a 25 kDa, GPI-linked membrane glycoprotein that belongs to immunoglobulin superfamily (PMID: 6177036; 6153212). Originally described as a brain thymus cross-reactive antigen, it is found in large quantities on mouse and rat thymocytes and central nervous system cells (PMID: 83175). CD90 has been postulated to be involved in cellular recognition, adherence, and T cell activation (PMID: 7683034).
Specification
Tested Reactivity: rat
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Eg1463 Product name: Recombinant Rat CD90/Thy1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-130 aa of NM_012673.2 Sequence: QRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVKC Predict reactive species
Full Name: Thy-1 cell surface antigen
Calculated Molecular Weight: 18 kDa
GenBank Accession Number: NM_012673.2
Gene Symbol: Thy1
Gene ID (NCBI): 24832
Conjugate: CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P01830
Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924