Iright
BRAND / VENDOR: Proteintech

Proteintech, G26056-1-5C, MultiPro® 5CFLX Anti-Human Ezrin (Polyclonal)

CATALOG NUMBER: G26056-1-5C
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 10ug The Ezrin (G26056-1-5C) by Proteintech is a Polyclonal antibody targeting Ezrin in Single Cell (Intra) applications with reactivity to Human samples G26056-1-5C targets Ezrin in Single Cell (Intra) applications and shows reactivity with Human samples. Tested Applications Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. Recommended dilution SINGLE CELL (INTRA): <0.5ug/test Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Oligo Conjugate Type: Polyclonal Immunogen: CatNo: Ag23530 Product name: Recombinant human Ezrin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 477-529 aa of BC013903 Sequence: VYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQR Predict reactive species Full Name: MultiPro® 5CFLX Anti-Human Ezrin (Polyclonal) Calculated Molecular Weight: 69 kDa GenBank Accession Number: BC013903 Gene Symbol: Ezrin Gene ID (NCBI): 7430 ENSEMBL Gene ID: ENSG00000092820 RRID: AB_3673895 Conjugate: 5CFLX Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGGCCACCAGTGGCTCCCCCATATAAGAAA Barcode Sequence: GCCACCAGTGGCTCC Form: Liquid UNIPROT ID: P15311 Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3. Storage Conditions: 2-8°C Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924